Tag Archives: Diazepam

Diazepam Binding Inhibitor (DBI) BioAssay™ ELISA Kit (Human), 024661-96Tests

Diazepam Binding Inhibitor (DBI) BioAssayTM ELISA Kit (Human) is a competitive inhibition enzyme immunoassay technique for the in vitro quantitative measurement of DBI in human serum, plasma and other biological fluids. Detection Range: 493.8-40,000pmol/L Sensitivity: 215.6pmol/L Storage and Stability: Desiccation recommended. The Standard, Detection Reagent A, Detection Reagent B and the 96-well strip plate should… Read More »

Diazepam Binding Inhibitor (DBI) (10ug)

Homo sapiens (Human) two N-terminal Tags, His-tag and S-tag protein expressed from E.coli Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI High-Quality Protein Shipped with Protein Data Information Sheet Multiple Quantities Available Please Request Further Information If Needed